PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre08.g358534.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family GATA
Protein Properties Length: 839aa    MW: 83504.6 Da    PI: 4.7359
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre08.g358534.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.12.2e-17229258130
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyy 30 
                         C+ Cg+t+Tp+WR+gp g+ktLCnaCG++y
  Cre08.g358534.t1.1 229 CVECGATQTPQWREGPAGPKTLCNACGVRY 258
                         ****************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS510388.16637159IPR001025Bromo adjacent homology (BAH) domain
SMARTSM004011.3E-12223277IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.479223258IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.7E-12226263No hitNo description
Gene3DG3DSA:3.30.50.103.9E-14226261IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.87E-12228258No hitNo description
PfamPF003208.3E-15229258IPR000679Zinc finger, GATA-type
PROSITE patternPS003440229254IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 839 aa     Download sequence    Send to blast
MQKATIEFFW LGAPQNAASV HESADRVYYT GFNLNGVTFQ AGEYVLLHPE EEASLHYVGK  60
LVKCFHDKSG AYGDPHCVEV AWFERAVVLE AGADLKELVE LAETDINPIG CISGKAYVLK  120
ASSLEEASQL AQASVPAHCE WFWCARALRA GVLLPCSELA DPAGASACGQ QAALPPQLSG  180
KRSLTGGQGS AEGAADSEEA EAKRSRLQPE EMPTAPVRRT GKLVSGRTCV ECGATQTPQW  240
REGPAGPKTL CNACGVRYVR AQQRANKRAV SMGSSRPSGG YGGRQSRASK SARAEPACGP  300
RGGARAAASA AAVEEVPQRP LRQAALLAAN KTAQYARTGV FPQSATELHQ HQQQPYGGLC  360
TLGELELVGR PGTPVCPSAT ASAGASACAD SLPEGVTVEV EVVVDGGDMD GGCCGGGAVS  420
PAMGLVAPFA ALPGVPGGYP QLQQFQQHHH QALTHMGLLP GAGCSPERPA AGTSGLTHMG  480
GAAAVQGMVP LAGHVVLLGA AAAPAAAAAA ADSTPSTSGT SGSGLAAGAG GDCCASELPA  540
AAMPLQHHLL HPHVMSVPVS PSAHQPAATA ACDLFVCGDE DEAGAGSHMG LYGAGQSGLL  600
GAGEDEEAFG SLVGAEVDFG LGAGSGDGSA ALFDVLLQPG GPGGHCCEGD LDGDLGVGVC  660
DLPDVAARAA PYCTDLAPGT AARQLLDAAP LLLMAGDVPL GCGAGSSCGT VAVAGGAEAE  720
AAVRQLVGLG AEAGRAATEA LAASEAAAAV EQAAEAHAEA ARRARDAAAC NLERLREAIC  780
GIAGPEAAAA VALDCSGLIE LPHSLGGGDG GAVCAGGLLG MGLGSSLFDD ASLVAVHS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Cre.123690.0normal conditions| nutrient deficiency
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00377DAPTransfer from AT3G24050Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre08.g358534.t1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001703730.10.0predicted protein
TrEMBLA8JID20.0A8JID2_CHLRE; Predicted protein
STRINGEDO963700.0(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2201430
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.12e-13GATA transcription factor 1